PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000280252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family TCP
Protein Properties Length: 335aa    MW: 34916.5 Da    PI: 5.6744
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000280252genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP107.22.6e-33601653105
            TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec.......eaesssssasnsssg... 88 
                     ++++++++hTkv+gR+RR+R++a+caar+F+L+ eLG  +d++t+ WLl+ a++ai+e+tgt++ +a ++               + +s+ +   
  MDP0000280252  60 IRRSSTKDRHTKVEGRGRRIRVPATCAARIFQLTXELGNESDGETVRWLLEHAEQAIIEATGTGTVPAIAVsvggslkI------PTTAST-Sved 148
                    5899***********************************************************8888855543222221......111111.1111 PP

            TCP  89 .kaaksaakskksqksaa 105
                     ++ +s+ ++k+++ s++
  MDP0000280252 149 nSSPPSS-TKKQKRPSNS 165
                    1111122.2222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.7E-2764163IPR005333Transcription factor, TCP
PROSITE profilePS5136923.43265119IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MTSYLEDQDD DGGASDLSTS TGDLGDNDHT NRDGVAYPIG MVPVAMPMPM SVPSTVSTLI  60
RRSSTKDRHT KVEGRGRRIR VPATCAARIF QLTXELGNES DGETVRWLLE HAEQAIIEAT  120
GTGTVPAIAV SVGGSLKIPT TASTSVEDNS SPPSSTKKQK RPSNSEFLDV ENDAVSQSSG  180
LAPVGPSVPQ GLVPVWAVGG PGLMVPANAL WIGPIWALPP TMTPVFNMAG AARPISSFVA  240
NRGGGGLGVL DVRAPSPPLS NSAANTSTVG PRAAMRSSTT MAPSVSSSSN NSNGTGSGAT  300
TKTQMLRDFS LEIYDKXELQ FMGRPVGPEN HHQTQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008374020.10.0PREDICTED: LOW QUALITY PROTEIN: transcription factor TCP9-like
TrEMBLM5WG461e-171M5WG46_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s08590.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.23e-58TCP family protein